PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A00354.1.p
Common NameEUGRSUZ_A00354
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GRAS
Protein Properties Length: 567aa    MW: 63839.8 Da    PI: 4.6005
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A00354.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS276.21e-841945642374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl....fsevsPi 90 
                        e Ll++Ae v  +++ +a+ lL +  el+ ++g+p++R++ yf eAL++++ r++ +++     ++ +  +++e  +  +l    ++++ P+
  Eucgr.A00354.1.p 194 AEILLAAAEKVGCQQFDAASVLLDQYDELCCSTGNPVERVVYYFSEALREKIDRETGRISIRGLGKRMTL-DVVEDSMKPSLpiitYYKLVPF 285
                       578***************************************************8888876555555543.344443433334566******* PP

              GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                        +++++   q+I+e v+ +++vH++Df+++ G+QW+ L++aL  +R+++   l+iT++g     s++ +e tg+rL+ fA+ ++vpf+f++++
  Eucgr.A00354.1.p 286 SQIQQFSSIQTIVENVADAKKVHVVDFGMQSGIQWMVLMHALVaQREHSLELLKITAIGT---CSQQVIEDTGKRLETFARLFHVPFSFKIIM 375
                       ******************************************858889999*********...689*************************** PP

              GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +++ +l+ + ++++ +E+++++ ++ l+r+     + +++ d+v+k++k+l+P v+vvve e++hns++F +rf+e l +ysa fd+le+ +
  Eucgr.A00354.1.p 376 LQDMLELKEDLFDLDGEESIVICAQFLLKRMI----PWPERLDSVIKVIKKLNPCVMVVVEVESNHNSPDFTNRFAEVLFFYSAYFDCLEECM 464
                       **************************999998....67777788************************************************* PP

              GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpL 367
                        r++e+r++ E ++lg+ ++  +a+eg+er+ r+ + + Wr+ ++++G+ +v ++     qa+l+ +k++ +   +++ + ++l++gWk+ pL
  Eucgr.A00354.1.p 465 ERDDENRTFFESVYLGQGLRTTLAAEGEERTIRNVKINVWRAFFSRFGMIEVDMGMASLYQAELMAKKFPcGSSCTLDMNGKCLIIGWKGTPL 557
                       **********************************************************************9999******************* PP

              GRAS 368 vsvSaWr 374
                       +s+SaW+
  Eucgr.A00354.1.p 558 FSLSAWQ 564
                       ******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.732167543IPR005202Transcription factor GRAS
PfamPF035143.6E-82194564IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
LSSSSQSYGR VIAGEGSQVP FSKAEDWGES EDISSFSDYG IHHSDLTRKQ ALFSENQQQE  60
QLQLSLSDYG LLNNLRCNAA SLPIQTCLDE INKFARISTE LQDIDEARKD KPFQISVSSL  120
ELLRNDGSGF KQLAGDGVLK PHTEHRQVEL STSETMMIAS AKYIQSSSGA GDDLALPDDF  180
SCLSEDKIRN VQLAEILLAA AEKVGCQQFD AASVLLDQYD ELCCSTGNPV ERVVYYFSEA  240
LREKIDRETG RISIRGLGKR MTLDVVEDSM KPSLPIITYY KLVPFSQIQQ FSSIQTIVEN  300
VADAKKVHVV DFGMQSGIQW MVLMHALVAQ REHSLELLKI TAIGTCSQQV IEDTGKRLET  360
FARLFHVPFS FKIIMLQDML ELKEDLFDLD GEESIVICAQ FLLKRMIPWP ERLDSVIKVI  420
KKLNPCVMVV VEVESNHNSP DFTNRFAEVL FFYSAYFDCL EECMERDDEN RTFFESVYLG  480
QGLRTTLAAE GEERTIRNVK INVWRAFFSR FGMIEVDMGM ASLYQAELMA KKFPCGSSCT  540
LDMNGKCLII GWKGTPLFSL SAWQFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3519956414375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A00354.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064972.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A059DBM40.0A0A059DBM4_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s15350.11e-172(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157861014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-53RGA-like 1